PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G04530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 285aa    MW: 28376.2 Da    PI: 6.2321
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G04530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.11.6e-5557152297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdrflPianvsrimk+ lPanakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe yv plk yl++yre+eg
  OMERI08G04530.1  57 KEQDRFLPIANVSRIMKRSLPANAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEAYVGPLKSYLNRYREAEG 150
                      89*******************************************************************************************9 PP

            NF-YB  96 ek 97 
                      ek
  OMERI08G04530.1 151 EK 152
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.4E-5154155IPR009072Histone-fold
SuperFamilySSF471131.52E-3859163IPR009072Histone-fold
PfamPF008087.9E-2762126IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.7E-1890108No hitNo description
PROSITE patternPS00685093109IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.7E-18109127No hitNo description
PRINTSPR006154.7E-18128146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MKSRKSYGHL LSPVGSPPSD NESGAAVAAA AAGGGGCGSS AGYVVYGGGG GGDSPAKEQD  60
RFLPIANVSR IMKRSLPANA KISKEAKETV QECVSEFISF VTGEASDKCQ REKRKTINGD  120
DLLWAMTTLG FEAYVGPLKS YLNRYREAEG EKAAVLGGAA AARHGEGGCC GGADGVVIDG  180
HSPLAGGLSS HSHQHHQQQD GGGDVGLMMG GGAAGVGYSA GAGSTTTAFY APAATAASGN  240
KAYCGGDGSR VMEFEGIGGE EESGGGGGGG GGERGFAGHL HGVQW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B8e-4557147292Transcription factor HapC (Eurofung)
4g91_B8e-4557147292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0621820.0AY062182.1 Oryza sativa (indica cultivar-group) HAP3-like transcriptional-activator (HAP3b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649101.11e-120PREDICTED: nuclear transcription factor Y subunit B-2
TrEMBLA0A0E0EIJ60.0A0A0E0EIJ6_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g07740.11e-120(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.19e-56nuclear factor Y, subunit B3